$100 minimum order|Contact us for questions

Protocols · MSK/Tissue Repair

TB-500 Tissue Repair Protocol

Thymosin Beta-4 Analog | Tissue Repair & Post-Surgical Recovery

InjectableTissue RepairMSKInvestigationalOff-Label

Typical Dose

2.5 mg

2x/week loading, 1x/week maintenance

Route

Subcutaneous

Abdomen or thigh; IM acceptable for deeper targets

Cycle

6–12 weeks

4–6 wk loading + 4–8 wk maintenance, then 4-wk washout

Storage

Refrigerate 2–8°C

Lyophilized vial stable at room temp; reconstituted product refrigerated up to 30 days

Patient version available. Share ?view=patient with patients for the plain-language handout.

Preview patient view →

Overview

This protocol targets chronic, non-healing soft-tissue injuries and accelerates recovery following orthopedic or reconstructive surgery in adult patients who have plateaued with conventional rehabilitation. Typical candidates include patients with chronic tendinopathies (rotator cuff, patellar, Achilles, lateral epicondyle), partial ligamentous tears managed non-operatively, post-surgical recovery (rotator cuff repair, ACL reconstruction, meniscal repair, post-arthroscopy), and refractory myofascial injuries.

TB-500 (the synthetic, more bioavailable analog of endogenous Thymosin Beta-4) is deployed as a systemic monotherapy to promote actin sequestration, endothelial migration, and progenitor cell recruitment to injured tissues. Unlike localized regenerative interventions (PRP, prolotherapy), systemic TB-4 is appropriate when injury is diffuse, multi-site, or anatomically difficult to inject, and when post-surgical patients need globalized repair signaling.

The protocol uses a loading-then-maintenance approach over 6–12 weeks. Patients generally pair pharmacologic therapy with progressive loading rehabilitation, since tissue remodeling requires mechanical signaling to organize new collagen architecturally.

Key Benefits

Promotes angiogenesis, cell migration, and progenitor recruitment to injured soft tissue. Particularly suited to chronic tendinopathy and post-surgical recovery where conventional rehab has plateaued.

Mechanism of Action

43-amino-acid G-actin sequestering peptide that drives cellular migration, upregulates VEGF-mediated angiogenesis, recruits bone-marrow progenitors via the SDF-1/CXCR4 axis, and suppresses NF-κB inflammatory signaling.

Molecular Information

Weight

4963 Da

Length

43 amino acids (parent TB-4)

Type

Synthetic Thymosin Beta-4 analog

Amino Acid Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

* TB-500 is the synthetic, more bioavailable analog of endogenous Thymosin Beta-4. Bioactive N-terminal fragment (Ac-SDKP) contributes to anti-fibrotic activity.

Pharmacokinetics

Peak: 1–2 hours post SC injectionHalf-life: ~2 hours (plasma); biologic effect outlasts plasma presenceCleared: Renal; intracellular actin binding prolongs tissue effect
0%50%100%Dose1d2d3d4d
PeakHalf-lifePharmacokinetic estimates from preclinical and Phase 2 human data

Research Indications

Chronic TendinopathyEMERGING

Rotator Cuff / Patellar / Achilles

Responders typically report 20–40% pain score reduction by week 8 when paired with loading rehab.

Lateral Epicondyle

Useful in refractory cases that have plateaued with eccentric loading and PRP.

Post-Surgical RecoveryEMERGING

Rotator Cuff Repair / ACL Reconstruction

Systemic repair signaling supports tissues anatomically difficult to inject locally.

Post-Arthroscopy

Reduces inflammatory burden and supports progenitor recruitment to surgical bed.

Soft-Tissue InjuryEMERGING

Partial Ligament Tears

Adjunct to non-operative management; supports collagen remodeling with mechanical loading.

Refractory Myofascial Injury

Appropriate when injury is diffuse or multi-site.

Dermal / Corneal RepairMIXED

Dry Eye, Pressure Ulcers

Phase 2 data (RGN-259, RGN-137) showed mixed results; no Phase 3 MSK trials exist.

Research Protocols

Disclaimer · These are commonly discussed research protocols and not medical advice. Consult a healthcare provider before use.
GoalDoseFrequencyRoute
Loading (Weeks 1–4)2.5 mg2x/weekSC abdomen/thigh
Extended Loading (Severe / Post-Surgical)2.5 mg2x/week × 6 weeksSC abdomen/thigh
Consolidation (Weeks 5–6)2.5 mg2x/weekSC abdomen/thigh
Maintenance (Weeks 7–12)2.5 mg1x/weekSC abdomen/thigh
Deep MSK Target2.5 mgPer phaseIM near injured tissue
Maximum Weekly Exposure5–7.5 mgWeekly capSC; empirical, not evidence-based above this

Timing · Inject on consistent days (e.g., Monday/Thursday during loading). Rotate injection sites. Pair with progressive loading rehab — tissue remodeling requires mechanical signaling for collagen organization.

Peptide Interactions

  • BPC-157SYNERGISTIC
  • GHK-CuSYNERGISTIC
  • CJC-1295 / IpamorelinSYNERGISTIC
  • Systemic CorticosteroidsAVOID
  • VEGF Inhibitors (bevacizumab, ranibizumab)AVOID
  • AnticoagulantsMONITOR
  • Thymosin Alpha-1COMPATIBLE
  • Semaglutide / TirzepatideCOMPATIBLE

How to Reconstitute

Important · Do not shake the vial — agitation can denature peptide structure. Discard reconstituted product after 30 days or if any cloudiness, discoloration, or particulate is observed.
  1. 1

    Remove 10 mg TB-500 vial and bacteriostatic water from refrigeration; allow to reach room temperature (5–10 min).

  2. 2

    Sanitize the rubber stopper of both vials with an alcohol swab.

  3. 3

    Draw 4 mL of bacteriostatic water into a sterile syringe.

  4. 4

    Insert needle into TB-500 vial at a 45° angle and slowly inject water down the inner wall of the vial — do not inject directly onto the lyophilized powder.

  5. 5

    Withdraw needle and gently swirl the vial. Do NOT shake — vigorous agitation can denature the peptide.

  6. 6

    Allow 1–2 minutes for full dissolution. Solution should be clear and colorless; discard if cloudy or particulate.

  7. 7

    Final concentration: 2.5 mg per 1.0 mL (10 mg ÷ 4 mL).

  8. 8

    Label vial with reconstitution date and concentration.

  9. 9

    Store reconstituted vial refrigerated at 2–8°C; use within 30 days.

  10. 10

    For each dose: draw 1.0 mL (2.5 mg) into an insulin syringe for SC administration.

  11. 11

    Rotate injection sites (abdomen, thigh) to minimize local irritation.

  12. 12

    Discard syringe in sharps container; never reuse needles.

Quality Indicators

  • Clear, colorless solution

    Properly reconstituted TB-500 is fully transparent with no visible particles.

  • Complete dissolution within 2 minutes

    Powder should fully dissolve with gentle swirling; no residual cake.

  • Mild foaming at surface

    Light foam is acceptable if solution underneath is clear; let settle before drawing.

  • Cloudy or hazy solution

    Indicates denaturation or contamination — discard vial.

  • Visible particulate

    Floating particles or sediment indicate product failure — do not inject.

What to Expect

  • Weeks 1–2: Possible mild lethargy or 'flu-like' sensation in first 1–2 doses, typically self-limited.

  • Week 4: Subjective reduction in pain and stiffness; improved tissue compliance on palpation.

  • Week 4–6: Some patients report improved sleep quality and reduced systemic inflammation symptoms.

  • Week 8: Measurable PROM improvement (20–40% pain reduction in responders); reduced hs-CRP if baseline elevated.

  • Week 8–10: Return-to-activity tolerance noticeably improved when paired with progressive loading.

  • Week 12: Maximum protocol benefit; ~60–75% of properly selected patients report clinically meaningful improvement.

  • Imaging changes (tendon architecture, reduced edema) often lag symptomatic improvement by months.

  • Non-response is real — patients should be counseled on realistic expectations and the importance of concurrent rehab.

Side Effects & Safety

  • Transient injection site erythema or mild bruising
  • Lethargy or 'flu-like' sensation in first 1–2 doses (self-limited)
  • Transient headache
  • Rare localized hypersensitivity at injection site
  • Mild fatigue during loading phase
  • Theoretical (not observed in short-term use): pro-angiogenic concerns in malignancy or proliferative retinopathy

When to Stop & Call Provider

  • Signs of allergic reaction (widespread rash, urticaria, swelling, dyspnea)
  • New or worsening vision changes (concern for proliferative retinopathy)
  • Unexplained mass, lymphadenopathy, or constitutional symptoms suggestive of occult malignancy
  • Severe or persistent injection site reactions
  • Pregnancy (suspected or confirmed) — no safety data
  • Persistent fatigue or systemic symptoms beyond the first 2 doses

References

Goldstein AL et al. — Thymosin β4: actin-sequestering protein moonlights to repair injured tissues

Mechanism reviewTrends in Molecular Medicine

Foundational review describing TB-4's actin sequestration, anti-inflammatory, anti-apoptotic, and angiogenic effects across cardiac, dermal, corneal, and CNS injury models.

Sosne G et al. — RGN-259 (TB-4) Phase 2 trials for dry eye disease

Phase 2Dry eyeMixed results

Phase 2 ophthalmic trials of topical TB-4 demonstrated symptomatic improvement in dry eye severity, though primary endpoints showed mixed statistical significance.

Crockford D et al. — Thymosin β4: structure, function, and biological properties supporting current and future clinical applications

Safety reviewAnn NY Acad Sci

Reviews preclinical safety and clinical development across pressure ulcer (RGN-137), dry eye, and cardiac indications. Favorable short-term safety profile; long-term oncologic data lacking.

Philp D, Kleinman HK — Animal studies of TB-4 in musculoskeletal repair

PreclinicalTendon/ligament

Animal models demonstrate accelerated tendon and ligament healing with systemic TB-4 administration via progenitor cell recruitment and improved collagen organization. Human MSK RCT data remain absent.

Related Peptides